Table 1 Polypeptide venom components of M. gulosa.

TPM, transcripts per million.

Mass (Da)TPMSequenceFeatures
MIITX1-Mg1a3144.8530120GLGRLIGKIAKKGAKIAAEAAANAAAEKAAEAL*
MIITX1-Mg2a8482.7829318LLSKDQALKHVWGVLKKLGKAAMEYVIQQICAKYNKK1 Cys (homodimer)
MIITX1-Mg3a4325.3216248KNEETMEEALKGLNELKERLKKQGIDTAALNLDEKLLT
MIITX-Mg4a9220.8511836SLVGCPRPDFLPSWNRCKSCVCKNNKLKCPKILKGSLLKTAA5 Cys (homodimer)
MIITX-Mg4b8876.522518SLVGCPRPNFLPSWNRCKCICKNNKPMCRKLPNLLKTTA5 Cys (homodimer?)
MIITX1-Mg5a2516.409654SINVKNLMDMIREQITSRLKK
MIITX1-Mg5b2515.423556SINVKNLMNMIREQITSRLKK
MIITX1-Mg6a1509.809484FRGPCLKIKGYKC2 Cys
MIITX1-Mg7a7110.848100KRSKSSSKTKPKKPKKPKKKIKIPDWVKSGGKMVGEAVAGAVADAAVSAVMDAAVGTTAEPEQ3 HexNAc
MIITX1-Mg7b5596.047808KRRRGLKKIIGKVIKGTGKVAGEAAASAVADAAVSAAIDAVVGTTEEPEQ3 HexNAc
MIITX1-Mg7c5736.174343KRRRRLRKIIRKVIKGTGKVAGEAAASAVAGAAVSAAIDAAVGTTEEPEQ3 HexNAc?
MIITX1-Mg8a7632.291027WLGALFSFIRFIAPYVIRAVRVLIQVVSKVVKPAKVAMKYAKKIATNVAKDVAKDMATDIAIDTITGGDE
MIITX1-Mg8b7373.97773WLGALFSFIRFIAPYVIKAIRFVVQVASKLVKPAKAAIKFAKNIAKDIAEDMAMDFAMDVITGGDDE
MIITX1-Mg9a3246.96861NIKWSKYAKKVGKVIVKHGIPLAASIALSQ*
MIITX2-Mg1a5787.375354DISDYGDPCSDDLKDYCIHGDCFFLKELNQPACRCYTGYYGSRCEHIDHN6 Cys
MIITX1-Mg10a?11791
MIITX3-Mg1a~19,4005208
CAP~24,200378
Phosphatase~43,70090
Esterase~61,80059
Hyaluronidase~38,70026
DPP-4~86,500233

*C-terminal amidation.

The TPM value is the sum of more than one assembled transcript encoding the same peptide.

Predicted mass (complete primary structure not confirmed by MS/MS).